{"product_id":"proteintech-30498-1-ap","title":"Proteintech, 30498-1-AP, CSN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CSN2 (30498-1-AP) by Proteintech is a Polyclonal antibody targeting CSN2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n30498-1-AP targets CSN2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HT-29 cells,  NIH\/3T3 cells,  mouse liver tissue,  mouse testis tissue,  DU 145 cells,  rat liver tissue\nPositive IHC detected in: human breast hyperplasia tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCSN2 is also named as Beta-casein and CASB.The β-casein is the most abundant protein in camel milk, and is one of the most important milk protein fractions  (PMID: 24973699).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27943 Product name: Recombinant human CSN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-226 aa of BC096194 Sequence: TIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV Predict reactive species\nFull Name: casein beta\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC096194\nGene Symbol: CSN2\nGene ID (NCBI): 1447\nRRID: AB_3086338\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05814\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886912983209,"sku":"30498-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30498-1-ap","provider":"Iright","version":"1.0","type":"link"}