{"product_id":"proteintech-30500-1-ap","title":"Proteintech, 30500-1-AP, TAPBP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAPBP (30500-1-AP) by Proteintech is a Polyclonal antibody targeting TAPBP in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n30500-1-AP targets TAPBP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-231 cells,  THP-1 cells\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAPBP, also known as tapasin, is a V-C1 (variable-constant) immunoglobulin superfamily (IgSF) molecule. It is involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (PMID: 11920573).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30885 Product name: Recombinant human TAPBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-120 aa of NM_003190 Sequence: GPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD Predict reactive species\nFull Name: TAP binding protein (tapasin)\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: NM_003190\nGene Symbol: TAPBP\nGene ID (NCBI): 6892\nRRID: AB_3086339\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15533\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887822852265,"sku":"30500-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30500-1-ap","provider":"Iright","version":"1.0","type":"link"}