{"product_id":"proteintech-30505-1-ap","title":"Proteintech, 30505-1-AP, ATG12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG12 (30505-1-AP) by Proteintech is a Polyclonal antibody targeting ATG12 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30505-1-AP targets ATG12 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, COLO 320 cells,  NIH\/3T3 cells,  PC-3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATG12, also named as APG12 and APG12L, belongs to the ATG12 family.  It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32268 Product name: Recombinant human ATG12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 48-187 aa of BC012266 Sequence: MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG Predict reactive species\nFull Name: ATG12 autophagy related 12 homolog (S. cerevisiae)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 20 kDa, 50-60 kDa\nGenBank Accession Number: BC012266\nGene Symbol: ATG12\nGene ID (NCBI): 9140\nRRID: AB_3086340\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94817\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869640282281,"sku":"30505-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30505-1-ap","provider":"Iright","version":"1.0","type":"link"}