{"product_id":"proteintech-30529-1-ap","title":"Proteintech, 30529-1-AP, C16orf75 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C16orf75 (30529-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf75 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30529-1-AP targets C16orf75 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, HeLa cells,  MCF-7 cells,  U-251 cells\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC16orf75 is also named as BLM-associated protein of 18 kDa (BLAP18), RMI2, hRMI2 and RecQ-mediated genome instability protein 2. C16orf75 is essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. And RMI2 is essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM (PMID: 18923082, PMID: 18923083, PMID: 27977684).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32880 Product name: Recombinant human C16orf75 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-147 aa of BC031016 Sequence: GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP Predict reactive species\nFull Name: chromosome 16 open reading frame 75\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC031016\nGene Symbol: C16orf75\nGene ID (NCBI): 116028\nRRID: AB_3086351\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96E14\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885473124521,"sku":"30529-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30529-1-ap","provider":"Iright","version":"1.0","type":"link"}