{"product_id":"proteintech-30539-1-ap","title":"Proteintech, 30539-1-AP, ALAS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALAS2 (30539-1-AP) by Proteintech is a Polyclonal antibody targeting ALAS2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30539-1-AP targets ALAS2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, NIH\/3T3 cells,  mouse brain tissue,  mouse heart tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe heme biosynthetic pathway begins from delta aminolevulinic acid synthase (ALAS) catalyzing the condensation of glycine and succinyl-CoA to delta aminolevulinic acid (ALA) in the mitochondria. ALAS is coded by two genes: ALAS1 and ALAS2 . ALAS1 is ubiquitously expressed in all cells, and the negative feedback is regulated by the heme pool; however, ALAS2 is specifically expressed only in erythroid cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30308 Product name: Recombinant human ALAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 502-574 aa of BC030230 Sequence: LLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA Predict reactive species\nFull Name: aminolevulinate, delta-, synthase 2\nCalculated Molecular Weight: 587 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC030230\nGene Symbol: ALAS2\nGene ID (NCBI): 212\nRRID: AB_3086355\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22557\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869806678185,"sku":"30539-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30539-1-ap","provider":"Iright","version":"1.0","type":"link"}