{"product_id":"proteintech-30540-1-ap","title":"Proteintech, 30540-1-AP, NOTCH3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOTCH3 (30540-1-AP) by Proteintech is a Polyclonal antibody targeting NOTCH3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n30540-1-AP targets NOTCH3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HeLa cells,  U2OS cells,  mouse lung tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOTCH3 (Neurogenic locus notch homolog protein 3) is one of four mammalian Notch proteins, which act as signalling receptors to control cell fate in many developmental and adult tissue contexts (PMID: 32210034). Notch is a transmembrane, developmental signalling receptor, which plays many crucial roles in developmental patterning, cell fate decisions, regulation of cell survival and proliferation (PMID:30246579). Genetic studies have shown that Notch3 gene knockouts are viable and have limited developmental defects, focussed mostly on defects in the arterial smooth muscle cell lineage. Notch3, in collaboration with other Notch proteins, is involved in stem cell regulation in different tissues in stem cell regulation in different tissues, and it also controls the plasticity of the vascular smooth muscle phenotype involved in arterial vessel remodelling. Overexpression, gene amplification and mis-activation of Notch3 are associated with different cancers, in particular triple negative breast cancer and ovarian cancer (PMID: 32210034).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30242 Product name: Recombinant human NOTCH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2203-2321 aa of NM_000435 Sequence: SPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA Predict reactive species\nFull Name: Notch homolog 3 (Drosophila)\nCalculated Molecular Weight: 244 kDa\nObserved Molecular Weight: 270 kDa, 90 kDa\nGenBank Accession Number: NM_000435\nGene Symbol: NOTCH3\nGene ID (NCBI): 4854\nRRID: AB_3086356\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UM47\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887740342441,"sku":"30540-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30540-1-ap","provider":"Iright","version":"1.0","type":"link"}