{"product_id":"proteintech-30549-1-ap","title":"Proteintech, 30549-1-AP, SYN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYN1 (30549-1-AP) by Proteintech is a Polyclonal antibody targeting SYN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30549-1-AP targets SYN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IMR-32 cells, SH-SY5Y cells,  SK-N-SH cells\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYN1, also named Synapsin I, Brain protein 4.1, belongs to the Synapsin family. SYN1 is a neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to regulate neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. Defects in SYN1 are a cause of epilepsy X-linked with variable learning disabilities and behavior disorders (XELBD). Synapsin I (SYN1) is composed of two isoforms, synapsin Ia and Ib, with molecular weights of 74 kDa and 70 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31091 Product name: Recombinant human SYN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 362-511 aa of NM_006950 Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPAGSPLPQRLPSP Predict reactive species\nFull Name: synapsin I\nCalculated Molecular Weight: 74 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: NM_006950\nGene Symbol: SYN1\nGene ID (NCBI): 6853\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17600\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868829634729,"sku":"30549-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30549-1-ap","provider":"Iright","version":"1.0","type":"link"}