{"product_id":"proteintech-30555-1-ap","title":"Proteintech, 30555-1-AP, MFSD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFSD2 (30555-1-AP) by Proteintech is a Polyclonal antibody targeting MFSD2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n30555-1-AP targets MFSD2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMFSD2 is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. MFSD2 is involved in the establishment of the blood-brain barrier and is required for brain growth and function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33064 Product name: Recombinant human MFSD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-219 aa of BC092414 Sequence: MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS Predict reactive species\nFull Name: major facilitator superfamily domain containing 2\nCalculated Molecular Weight: 543 aa, 60 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC092414\nGene Symbol: MFSD2\nGene ID (NCBI): 84879\nRRID: AB_3086361\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NA29\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559345321,"sku":"30555-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30555-1-ap","provider":"Iright","version":"1.0","type":"link"}