{"product_id":"proteintech-30602-1-ap","title":"Proteintech, 30602-1-AP, GHSR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GHSR (30602-1-AP) by Proteintech is a Polyclonal antibody targeting GHSR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n30602-1-AP targets GHSR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TT cells\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Growth Hormone Secretagogue Receptor (GHSR), also known as the ghrelin receptor, is a G protein-coupled receptor (GPCR) that plays a crucial role in regulating energy homeostasis, body weight, and growth hormone (GH) release. The GHSR is highly expressed in the brain, and also in some peripheral tissues. GHSR activity is evoked by the stomach-derived peptide hormone ghrelin and abrogated by the intestine-derived liver antimicrobial peptide 2 (LEAP2). (PMID: 33157147)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30358 Product name: Recombinant human GHSR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of NM_198407 Sequence: MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFR Predict reactive species\nFull Name: growth hormone secretagogue receptor\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: NM_198407\nGene Symbol: GHSR\nGene ID (NCBI): 2693\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92847\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887650918569,"sku":"30602-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30602-1-ap","provider":"Iright","version":"1.0","type":"link"}