{"product_id":"proteintech-30607-1-ap","title":"Proteintech, 30607-1-AP, EYA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EYA2 (30607-1-AP) by Proteintech is a Polyclonal antibody targeting EYA2 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30607-1-AP targets EYA2 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEYA2, also named EAB1, belongs to the HAD-like hydrolase superfamily and EYA family. It coactivates SIX1. The Six1-EYA2 interaction may inhibit breast cancer progression. EYA2 is required for Six1-activated TGF-beta signaling.(PMID:21706047) It may be involved in the development of the eye. This protein has  3 isoforms produced by alternative splicing with the molecular weight of 59 kDa, 57 kDa, and 50 kDa. It can be detected two bands of 70 kDa and 56 kDa in the neuroblastoma cells by western blot(PMID:12039049).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31827 Product name: Recombinant human EYA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 125-400 aa of BC013882 Sequence: MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD Predict reactive species\nFull Name: eyes absent homolog 2 (Drosophila)\nCalculated Molecular Weight: 64 kDa\nGenBank Accession Number: BC013882\nGene Symbol: EYA2\nGene ID (NCBI): 2139\nRRID: AB_3669738\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00167\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887628996777,"sku":"30607-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30607-1-ap","provider":"Iright","version":"1.0","type":"link"}