{"product_id":"proteintech-30621-1-ap","title":"Proteintech, 30621-1-AP, ADH1C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADH1C (30621-1-AP) by Proteintech is a Polyclonal antibody targeting ADH1C in WB, ELISA applications with reactivity to mouse, rat samples\n30621-1-AP targets ADH1C in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, mouse colon tissue,  rat colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlcohol dehydrogenase 1C(ADH1C), also known as ADH3, is an alcohol dehydrogenase that can catalyze ethanol oxidation to metabolite acetaldehyde. According to THE HUMAN PROTEIN ATLAS database, ADH1C locates mainly to the cytosol and plasma membrane. Genetic polymorphism of the ADH1C gene (ADH1C*1 allele) is associated with various human cancers, such as gastric cancer, oral cancer  and CRC, for it encodes an alcohol dehydrogenase producing 2.5 times more acetaldehyde.(PMID: 35300114)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33037 Product name: Recombinant human ADH1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-374 aa of BC062476 Sequence: ECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGQLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGFDLLRSGKSIRTVLT Predict reactive species\nFull Name: alcohol dehydrogenase 1C (class I), gamma polypeptide\nCalculated Molecular Weight: 375 aa, 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC062476\nGene Symbol: ADH1C\nGene ID (NCBI): 126\nRRID: AB_3086375\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00326\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869803597993,"sku":"30621-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30621-1-ap","provider":"Iright","version":"1.0","type":"link"}