{"product_id":"proteintech-30635-1-ap","title":"Proteintech, 30635-1-AP, AMAC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMAC1 (30635-1-AP) by Proteintech is a Polyclonal antibody targeting AMAC1 in WB, ELISA applications with reactivity to Mouse samples\n30635-1-AP targets AMAC1 in WB, ELISA applications and shows reactivity with Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMAC1, also known as SLC35G3. It is expected to be located in cell membrane, the protein is mainly expressed in testis. The calculated molecular weight of AMAC1 is 35 kDa. The gene encoding this protein appears to have arisen by SVA-mediated retrotransposition of the SLC35G6 gene in the primate lineage.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30356 Product name: Recombinant human S35G3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_152462 Sequence: MAGSHPYFNQPDSTHPSPPSAPPSLRWYQRCQPSDATSGLLVALLGGGLPAGFVGPLSRMAYQASNLPSLELLIWRCLFHLPIALLLKLRGDPLLGTPDIRSRAFFCALLNILSIGCAYSAVQVVPAGNAATVRKGSSTVCSAVLTLCLE Predict reactive species\nFull Name: acyl-malonyl condensing enzyme 1\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: NM_152462\nGene Symbol: AMAC1\nGene ID (NCBI): 146861\nRRID: AB_3669742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N808\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869808611497,"sku":"30635-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30635-1-ap","provider":"Iright","version":"1.0","type":"link"}