{"product_id":"proteintech-30639-1-ap","title":"Proteintech, 30639-1-AP, TMEM33 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM33 (30639-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM33 in WB, ELISA applications with reactivity to mouse, rat samples\n30639-1-AP targets TMEM33 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM33 (transmembrane protein 33), also known as DB83. It is expected to be located in endoplasmic reticulum membrane and nucleus envelope. The protein is widely expressed in prostate cancer and several cancer cell lines (at protein level). And expressed at higher levels in endocrine-resistant breast cancer cells as compared to endocrine-sensitive breast cancer cells. It is also expressed at higher levels in early recurrence breast cancer tissues as compared to non-recurrent breast tumors. The calculated molecular weight of TMEM33 is 28 kDa. It is suggest that TMEM33 has a potency to suppress the membrane-shaping activity of reticulons, thereby regulating the tubular structure of ER (PMID: 25612671).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32368 Product name: Recombinant human TMEM33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-247 aa of BC000948 Sequence: SGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP Predict reactive species\nFull Name: transmembrane protein 33\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC000948\nGene Symbol: TMEM33\nGene ID (NCBI): 55161\nRRID: AB_3669743\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P57088\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887832551593,"sku":"30639-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30639-1-ap","provider":"Iright","version":"1.0","type":"link"}