{"product_id":"proteintech-30640-1-ap","title":"Proteintech, 30640-1-AP, ZFP36L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZFP36L2 (30640-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP36L2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30640-1-AP targets ZFP36L2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HepG2 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZFP36L2 (Zinc finger protein 36 like 2) is an RNA-binding protein, belonging to the ZFP36 family, which regulates gene expression at the post-transcriptional level by binding and destabilizing certain AU-rich element (ARE) located in the 3′ untranslated regions (3′UTRs) of mRNA (PMID: 29518627). Moreover, ZFP36L2 is a key protein that controls S-phase progression in the case of genome instability (PMID: 29449217).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32428 Product name: Recombinant human ZFP36L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-482 aa of BC005010 Sequence: SCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQQQQGLAPPAQPPAPPSATLPAGAAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDP Predict reactive species\nFull Name: zinc finger protein 36, C3H type-like 2\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC005010\nGene Symbol: ZFP36L2\nGene ID (NCBI): 678\nRRID: AB_3669744\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P47974\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887929577641,"sku":"30640-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30640-1-ap","provider":"Iright","version":"1.0","type":"link"}