{"product_id":"proteintech-30657-1-ap","title":"Proteintech, 30657-1-AP, PTGIR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTGIR (30657-1-AP) by Proteintech is a Polyclonal antibody targeting PTGIR in WB, ELISA applications with reactivity to human samples\n30657-1-AP targets PTGIR in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, SGC-7901 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProstaglandin I2 receptor (PTGIR), also known as IP, is a seven-transmembrane receptor that binds G proteins leading to activation of adenylyl cyclase and an increase in cAMP formation. PTGIR is involved in insulin secretion in pancreatic beta-cells and in permselectivity in glomerular podocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30653 Product name: Recombinant human PTGIR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 296-386 aa of BC075814 Sequence: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC Predict reactive species\nFull Name: prostaglandin I2 (prostacyclin) receptor (IP)\nCalculated Molecular Weight: 386 aa, 41 kDa\nObserved Molecular Weight: 41-45kDa\nGenBank Accession Number: BC075814\nGene Symbol: PTGIR\nGene ID (NCBI): 5739\nRRID: AB_3669746\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43119\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776747689,"sku":"30657-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30657-1-ap","provider":"Iright","version":"1.0","type":"link"}