{"product_id":"proteintech-30658-1-ap","title":"Proteintech, 30658-1-AP, ZBTB7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBTB7A (30658-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB7A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30658-1-AP targets ZBTB7A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, MCF-7 cells,  PC-3 cells,  SGC-7901 cells,  U2OS cells\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBTB7A, also named as LRF, FBI1, FBI-1, pokemon, ZBTB7, ZNF857A and DKFZp547O146, a member of the POK (POZ and Krüppel) family of transcription factors, plays a role in differentiation, oncogenesis, and adipogenesis (PMID: 35798238). ZBTB7A is involved in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. ZBTB7A is widely expressed in normal thymus and it is aberrantly overexpressed in human cancers (PMID: 28942243). ZBTB7A has 10 potential sumoylation sites located at lysine 61, 354, 371, 379, 383, 396, 486, 487, 536 and 539 (PMID: 20471975, 19471103). ZBTB7A has a predicted molecular weight of 61 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31077 Product name: Recombinant human ZBTB7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 459-584 aa of NM_015898 Sequence: VHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA Predict reactive species\nFull Name: zinc finger and BTB domain containing 7A\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 61-70 kDa\nGenBank Accession Number: NM_015898\nGene Symbol: ZBTB7A\nGene ID (NCBI): 51341\nRRID: AB_3669747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95365\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887927120041,"sku":"30658-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30658-1-ap","provider":"Iright","version":"1.0","type":"link"}