{"product_id":"proteintech-30691-1-ap","title":"Proteintech, 30691-1-AP, CD86 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD86 (30691-1-AP) by Proteintech is a Polyclonal antibody targeting CD86 in WB, ELISA applications with reactivity to mouse, rat samples\n30691-1-AP targets CD86 in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DC2.4 cells, NR8383 cells,  J774A.1 cells,  RAW 264.7 cells,  mouse spleen tissue,  rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33514 Product name: Recombinant mouse Cd86 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-244 aa of NM_019388 Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWK Predict reactive species\nFull Name: CD86 antigen\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_019388\nGene Symbol: Cd86\nGene ID (NCBI): 12524\nRRID: AB_3086387\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42082-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887956086953,"sku":"30691-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30691-1-ap","provider":"Iright","version":"1.0","type":"link"}