{"product_id":"proteintech-30693-1-ap","title":"Proteintech, 30693-1-AP, GCNA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GCNA (30693-1-AP) by Proteintech is a Polyclonal antibody targeting GCNA in WB, ELISA applications with reactivity to Human samples\n30693-1-AP targets GCNA in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, PC-3 cells,  SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGerm cell nuclear acidic protein (GCNA) has been extensively used as a germ cell marker for almost 30 years. Recently, mutations in GCNA have been linked to azoospermia in humans, defining GCNA as a clinical determinant of human infertility.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33720 Product name: Recombinant human ACRC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC136259 Sequence: MDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPKRQASSVVVIDSDSDEECHTHEEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLE Predict reactive species\nFull Name: acidic repeat containing\nCalculated Molecular Weight: 691 aa, 76 kDa\nObserved Molecular Weight: 76 kDa\nGenBank Accession Number: BC136259\nGene Symbol: GCNA\nGene ID (NCBI): 93953\nRRID: AB_3086389\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96QF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887648952489,"sku":"30693-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30693-1-ap","provider":"Iright","version":"1.0","type":"link"}