{"product_id":"proteintech-30703-1-ap","title":"Proteintech, 30703-1-AP, CD49b Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD49b (30703-1-AP) by Proteintech is a Polyclonal antibody targeting CD49b in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30703-1-AP targets CD49b in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, A431 cells,  HeLa cells,  MDA-MB-231 cells\nPositive IHC detected in: human colon  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-2 (ITGA2, CD49b) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor (VLA-2) for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32771 Product name: Recombinant human ITGA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 840-1132 aa of NM_002203 Sequence: GIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPT Predict reactive species\nFull Name: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)\nCalculated Molecular Weight: 126 kDa\nObserved Molecular Weight: 140-150 kDa\nGenBank Accession Number: NM_002203\nGene Symbol: Integrin alpha 2\nGene ID (NCBI): 3673\nRRID: AB_3669752\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17301\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886272565417,"sku":"30703-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30703-1-ap","provider":"Iright","version":"1.0","type":"link"}