{"product_id":"proteintech-30714-1-ap","title":"Proteintech, 30714-1-AP, Integrin alpha-8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin alpha-8 (30714-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-8 in WB, IHC, IF-P, ELISA applications with reactivity to Human,  Mouse, Rat samples\n30714-1-AP targets Integrin alpha-8 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human,  Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue,  rat spleen tissue\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. Integrin alpha-8 is a single-pass type I membrane protein that forms a heterodimer with integrin beta-1 to serve as a receptor for RGD-containing matrix molecules (fibronectin, vitronectin, tenascin C, osteopontin, and nephronectin) (PMID: 33000355). Integrin alpha-8 beta-1 plays a critical role in epithelial-mesenchymal interactions and functions in the genesis of kidney and probably of other organs (PMID: 9054500; 19769957). The apparent molecular weight of integrin alpha-8 is larger than the calculated molecular weight of 117 kDa, possibly due to glycosylation (PMID: 7768999).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33507 Product name: Recombinant human Integrin alpha-8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 791-970 aa of NM_003638 Sequence: GVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALAS Predict reactive species\nFull Name: integrin, alpha 8\nCalculated Molecular Weight: 117 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_003638\nGene Symbol: Integrin alpha 8\nGene ID (NCBI): 8516\nRRID: AB_3086397\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53708\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869698871465,"sku":"30714-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30714-1-ap","provider":"Iright","version":"1.0","type":"link"}