{"product_id":"proteintech-30718-1-ap","title":"Proteintech, 30718-1-AP, MGAT4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MGAT4B (30718-1-AP) by Proteintech is a Polyclonal antibody targeting MGAT4B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30718-1-AP targets MGAT4B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse liver tissue, human liver tissue\nPositive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMGAT4B belongs to the  N-Acetylglucosaminyltransferase-IV family and catalyzes the transfer of GlcNAc from UDP-GlcNAc to the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans through a beta1-4 linkage and participates in the production of tri- and tetra-antennary N-linked sugar chains (PMID: 17006639, 10372966). MGAT4B has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor to N-glycan biosynthesis (PMID:17006639).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33769 Product name: Recombinant human MGAT4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-446 aa of BC009464 Sequence: KTYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILSEIFLKKAD Predict reactive species\nFull Name: mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme B\nCalculated Molecular Weight: 548 aa, 63 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC009464\nGene Symbol: MGAT4B\nGene ID (NCBI): 11282\nRRID: AB_3086399\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQ53\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887718977705,"sku":"30718-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30718-1-ap","provider":"Iright","version":"1.0","type":"link"}