{"product_id":"proteintech-30765-1-ap","title":"Proteintech, 30765-1-AP, GPAT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPAT3 (30765-1-AP) by Proteintech is a Polyclonal antibody targeting GPAT3 in WB, IHC, ELISA applications with reactivity to human samples\n30765-1-AP targets GPAT3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HT-1080 cells,  A375 cells,  Jurkat cells,  MKN-45 cells\nPositive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPAT3, also known as AGPAT9, is a member of the lysophosphatidic acid acyltransferase protein family. GPAT3 is an enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33717 Product name: Recombinant human GPAT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-136 aa of Glycerol-3-phosphate acyltransferase 3 Sequence: SEIYMKILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQY* Predict reactive species\nFull Name: 1-acylglycerol-3-phosphate O-acyltransferase 9\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: Glycerol-3-phosphate acyltransferase 3\nGene Symbol: AGPAT9\nGene ID (NCBI): 84803\nRRID: AB_3086413\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53EU6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887655047337,"sku":"30765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30765-1-ap","provider":"Iright","version":"1.0","type":"link"}