{"product_id":"proteintech-30843-1-ap","title":"Proteintech, 30843-1-AP, SLC6A20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC6A20 (30843-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A20 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n30843-1-AP targets SLC6A20 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HEK-293 cells,  rat kidney tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC6A20 also known as XT3, SIT1, belongs to the family of solute carrier 6, mediating the transport of neutral amino acids from the extracellular milieu toward cell or storage vesicles utilizing an electric membrane potential as the driving force. SLC6A20 is expressed in the kidney and small intestine and is localized in the brush marginal membrane of the proximal renal tubules (PMID: 16174864). Mutations in SLC6A20 are associated with Hyperglycinuria and Iminoglycinuria (PMID: 19033659)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33967 Product name: Recombinant human SLC6A20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 298-389 aa of BC136431 Sequence: YGFKATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQGTGLAFIVYTEAIKNMEVSQ Predict reactive species\nFull Name: solute carrier family 6 (proline IMINO transporter), member 20\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC136431\nGene Symbol: SLC6A20\nGene ID (NCBI): 54716\nRRID: AB_3669764\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NP91\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887807713449,"sku":"30843-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30843-1-ap","provider":"Iright","version":"1.0","type":"link"}