{"product_id":"proteintech-30847-1-ap","title":"Proteintech, 30847-1-AP, EGFR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGFR (30847-1-AP) by Proteintech is a Polyclonal antibody targeting EGFR in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30847-1-AP targets EGFR in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse liver tissue\nPositive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe epidermal growth factor receptor (EGFR) is a member of the ErbB family of receptor tyrosine kinases (RTKs). Binding of EGFR to epidermal growth factor family ligands triggers a signaling cascade through allosteric activation of epidermal growth factor receptor kinase and trans-autophosphorylation of key tyrosine residues in the tail of the cytoplasmic receptor (PMID: 24691965). Due to phosphorylation, the apparent molecular weight is higher than the calculated molecular weight of 140 kDa. EFGR has been implicated in learning and memory enhancement and pain signaling in mammals (PMID: 20639532 and 35131940).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33621 Product name: Recombinant mouse Egfr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 988-1210 aa of NM_207655 Sequence: RMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRVAPPSSEFIGA* Predict reactive species\nFull Name: epidermal growth factor receptor\nCalculated Molecular Weight: 135 kDa\nObserved Molecular Weight: 140-180 kDa\nGenBank Accession Number: NM_207655\nGene Symbol: Egfr\nGene ID (NCBI): 13649\nRRID: AB_3086421\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q01279\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869533917353,"sku":"30847-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30847-1-ap","provider":"Iright","version":"1.0","type":"link"}