{"product_id":"proteintech-30851-1-ap","title":"Proteintech, 30851-1-AP, SSR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SSR3 (30851-1-AP) by Proteintech is a Polyclonal antibody targeting SSR3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n30851-1-AP targets SSR3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U-87 MG cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammalian TRAP is a heterotetrameric membrane protein complex which comprised of four membrane proteins\/subunits: alpha, beta, gamma, and delta. SSR3 is also known as translocon-associated protein subunit gamma (TRAPG). The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. SSR3 assumes a central position in the mammalian TRAP complex, binding to the ribosome on the cytosolic face of the ER membrane and coordinating the remaining TRAP subunits with the ribosome and the other translocon components.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28130 Product name: Recombinant human SSR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-140 aa of BC017203 Sequence: TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFY Predict reactive species\nFull Name: signal sequence receptor, gamma (translocon-associated protein gamma)\nCalculated Molecular Weight: 185 aa, 21 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC017203\nGene Symbol: SSR3\nGene ID (NCBI): 6747\nRRID: AB_3086422\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UNL2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869771845801,"sku":"30851-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30851-1-ap","provider":"Iright","version":"1.0","type":"link"}