{"product_id":"proteintech-30861-1-ap","title":"Proteintech, 30861-1-AP, SGLT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGLT1 (30861-1-AP) by Proteintech is a Polyclonal antibody targeting SGLT1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n30861-1-AP targets SGLT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated rat kidney tissue, HeLa cells,  mouse colon tissue,  Jurkat cells,  Raji cells,  mouse kidney tissue,  mouse small intestine tissue,  rat colon tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC5A1, also known as SGLT1, is a sodium-dependent glucose transporter (SGLT) family member. SGLT1 couples sugar transport to Na+ gradients across the intestinal brush border (PMID: 8563765). SGLT1 mediates active glucose and galactose absorption in the intestine and renal glucose scavenging. Mutations in SGLT1 cause glucose-galactose malabsorption (GGM) syndrome (PMID: 34880492). SGLT1 is expressed in intestine and endometrial cells (PMID: 2490366, 28974690).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29338 Product name: Recombinant human SLC5A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 564-643 aa of NM_000343 Sequence: RNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRT Predict reactive species\nFull Name: solute carrier family 5 (sodium\/glucose cotransporter), member 1\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: NM_000343\nGene Symbol: SGLT1\nGene ID (NCBI): 6523\nRRID: AB_3669767\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13866\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869429944489,"sku":"30861-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30861-1-ap","provider":"Iright","version":"1.0","type":"link"}