{"product_id":"proteintech-30868-1-ap","title":"Proteintech, 30868-1-AP, MPC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPC1 (30868-1-AP) by Proteintech is a Polyclonal antibody targeting MPC1 in WB, ELISA applications with reactivity to human samples\n30868-1-AP targets MPC1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPC1, also known as BRP44L. BRP44L is predicted to be located in Mitochondrion inner membrane. The protein forms a heterodimer with MPC2, and the heterodimer is a more stable and dominant form (PMID:26253029, PMID:32403431). Mpc1 and Mpc2 associate to form an ~150-kilodalton complex in the inner mitochondrial membrane. Yeast and Drosophila mutants lacking MPC1 display impaired pyruvate metabolism, with an accumulation of upstream metabolites and a depletion of tricarboxylic acid cycle intermediates. Loss of yeast Mpc1 results in defective mitochondrial pyruvate uptake, and silencing of MPC1 or MPC2 in mammalian cells impairs pyruvate oxidation. A point mutation in MPC1 provides resistance to a known inhibitor of the mitochondrial pyruvate carrier (PMID: 22628558).The molecular weight of  MPC1 is 12 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag28826 Product name: Recombinant human BRP44L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC000810 Sequence: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA Predict reactive species\nFull Name: brain protein 44-like\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa, 20-24 kDa\nGenBank Accession Number: BC000810\nGene Symbol: BRP44L\nGene ID (NCBI): 51660\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5U8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887722811561,"sku":"30868-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30868-1-ap","provider":"Iright","version":"1.0","type":"link"}