{"product_id":"proteintech-30905-1-ap","title":"Proteintech, 30905-1-AP, PNPLA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PNPLA1 (30905-1-AP) by Proteintech is a Polyclonal antibody targeting PNPLA1 in WB, ELISA applications with reactivity to human, mouse samples\n30905-1-AP targets PNPLA1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPNPLA1 is a member of the patatin-like phospholipase (PNPLA) family. PNPLAs are highly conserved enzymes of prokaryotic and eukaryotic organisms that play an important role in lipid homeostasis. PNPLA1 has been identified as an essential transacylase for acylceramide biosynthesis to maintain the epidermal permeability barrier (PMID: 30290227). It is mainly expressed in the skin and has 3 isoforms with MW of 58, 48 and 49 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34139 Product name: Recombinant human PNPLA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC103907 Sequence: MVQMMRQFLYRVLPEDSYKVTTGKLHVSLTRLTDGENVVVSEFTSKEELIEALYCSCFV Predict reactive species\nFull Name: patatin-like phospholipase domain containing 1\nCalculated Molecular Weight: 532 aa, 58 kDa\nObserved Molecular Weight: 48kDa;58kDa\nGenBank Accession Number: BC103907\nGene Symbol: PNPLA1\nGene ID (NCBI): 285848\nRRID: AB_3669778\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N8W4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887767310505,"sku":"30905-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30905-1-ap","provider":"Iright","version":"1.0","type":"link"}