{"product_id":"proteintech-30910-1-ap","title":"Proteintech, 30910-1-AP, SMAGP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMAGP (30910-1-AP) by Proteintech is a Polyclonal antibody targeting SMAGP in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30910-1-AP targets SMAGP in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse colon tissue,  mouse lung tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall transmembrane and glycosylated protein (SMAGP) consists of 97 amino acids and contains a transmembrane domain. SMAGP localizes to the lateral face of the plasma membrane and is expressed in the cytoplasm after cell transformation. (PMID: 30410350)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34278 Product name: Recombinant human LOC57228 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-97 aa of BC120965 Sequence: VVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI Predict reactive species\nFull Name: small trans-membrane and glycosylated protein\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC120965\nGene Symbol: SMAGP\nGene ID (NCBI): 57228\nRRID: AB_3669781\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q0VAQ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887809319081,"sku":"30910-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30910-1-ap","provider":"Iright","version":"1.0","type":"link"}