{"product_id":"proteintech-30966-1-ap","title":"Proteintech, 30966-1-AP, IL-1RAP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-1RAP (30966-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1RAP in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30966-1-AP targets IL-1RAP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human placenta tissue,  mouse liver tissue\nPositive IHC detected in: human placenta tissue, human intrahepatic cholangiocarcinoma tissue,  human ovary cancer tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-1RAP (Interleukin-1 receptor accessory protein), also known as IL-1RAcP, IL-1R-3, or IL-1R3, is a member of the interleukin-1 receptor family. IL-1RAP is composed of an extracellular region containing three Ig-like C2 type domains, a transmembrane region, and a cytoplasmic region with a TIR (Toll-IL-1-receptor) domain. IL-1RAP functions as a co-receptor for IL-1, IL-33, IL-36. It plays an essential role in the signaling of the IL-1 family cytokines such as IL-1, IL-33, and IL-36, as well as tyrosine kinases FLT3 and c-Kit. IL-1RAP can also exist in a soluble form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34121 Product name: Recombinant human IL1RAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 389-570 aa of NM_001167928.1 Sequence: YRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQGLSYSSLKNV Predict reactive species\nFull Name: interleukin 1 receptor accessory protein\nCalculated Molecular Weight: 65 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001167928.1\nGene Symbol: IL1RAP\nGene ID (NCBI): 3556\nRRID: AB_3669798\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NPH3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869697462441,"sku":"30966-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30966-1-ap","provider":"Iright","version":"1.0","type":"link"}