{"product_id":"proteintech-30971-1-ap","title":"Proteintech, 30971-1-AP, SLC6A9 \/ GlyT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC6A9 \/ GlyT1 (30971-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A9 \/ GlyT1 in WB, ELISA applications with reactivity to human samples\n30971-1-AP targets SLC6A9 \/ GlyT1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC6A9, also named glycine transporter 1 (GlyT1),  is a transporter protein of the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters. GlyT1 is the main regulator of synaptic glycine concentrations, assisted by the neuronal GlyT2 (PMID: 28828604). The 55-60 kDa band is the partially glycosylated form of GlyT1 (PMID: 27874011, PMID: 8995423).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34437 Product name: Recombinant human SLC6A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-285 aa of NM_201649 Sequence: SSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE Predict reactive species\nFull Name: solute carrier family 6 (neurotransmitter transporter, glycine), member 9\nCalculated Molecular Weight: 706 aa, 78 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_201649\nGene Symbol: SLC6A9\nGene ID (NCBI): 6536\nRRID: AB_3669799\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48067\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887807778985,"sku":"30971-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30971-1-ap","provider":"Iright","version":"1.0","type":"link"}