{"product_id":"proteintech-30979-1-ap","title":"Proteintech, 30979-1-AP, AMAC1L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMAC1L2 (30979-1-AP) by Proteintech is a Polyclonal antibody targeting AMAC1L2 in WB, ELISA applications with reactivity to human samples\n30979-1-AP targets AMAC1L2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMAC1L2, also known as SLC35G5, belongs to the transporter protein family 35 member G5. This protein has an N-terminal α-helix, a central β-side and a C-terminal structural domain at the cell membrane. The role of SLC35G5 in the tumor microenvironment as a drug target and also as a biomarker for diagnosis and treatment monitoring.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34353 Product name: Recombinant human AMAC1L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-36 aa of BC131696 Sequence: MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGA Predict reactive species\nFull Name: acyl-malonyl condensing enzyme 1-like 2\nCalculated Molecular Weight: 388 aa, 35 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC131696\nGene Symbol: AMAC1L2\nGene ID (NCBI): 83650\nRRID: AB_3669803\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96KT7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869808677033,"sku":"30979-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30979-1-ap","provider":"Iright","version":"1.0","type":"link"}