{"product_id":"proteintech-30989-1-ap","title":"Proteintech, 30989-1-AP, FPR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FPR2 (30989-1-AP) by Proteintech is a Polyclonal antibody targeting FPR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30989-1-AP targets FPR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe formyl peptide receptors (FPRs) are a group of G protein-coupled chemoattractant receptors that play important roles in host defense and inflammation (PMID: 28335409). In humans, three different isoforms are expressed (FPR1, FPR2, and FPR3). FPR2, also known as FPRL1 or ALX, is expressed by many cell types including monocytes, neutrophils, macrophages, astrocytoma cells, and epithelial cells. FPR2 conveys the biological functions of a variety of ligands, including N-formyl-methionyl peptides, the pro-resolution mediators annexin A1 (AnxA1) and lipoxin A4, as well as the activating and proinflammatory protein serum amyloid A (PMID: 22610094).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34304 Product name: Recombinant human FPR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-350 aa of BC029125 Sequence: MLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA Predict reactive species\nFull Name: formyl peptide receptor 2\nCalculated Molecular Weight: 351 aa, 39 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC029125\nGene Symbol: FPR2\nGene ID (NCBI): 2358\nRRID: AB_3669809\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P25090\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887643185321,"sku":"30989-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30989-1-ap","provider":"Iright","version":"1.0","type":"link"}