{"product_id":"proteintech-30999-1-ap","title":"Proteintech, 30999-1-AP, Glypican-5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Glypican-5 (30999-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican-5 in WB, ELISA applications with reactivity to human samples\n30999-1-AP targets Glypican-5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NCI-H1299 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlypican-5 (GPC5), which is predicted to be located in the cell membrane. In adult, primarily expressed in the brain. Also detected in fetal brain, lung and liver (PMID: 9070915). Glypican-5 is a member of heparan sulfate proteoglycans. The repressive role of GPC5 intumorigenesis has been reported in a variety of cancers, including rhabdomyosarcoma, breast cancer, and prostate cancer. GPC5, which is lowly expressed in lung cancer tissues compared with adjacent noncancerous tissues, exhibits a suppressive effect on migration and invasion, and it can also induce G1\/S phase arrest of the lung cancer cells in vitro, which is associated with a better prognosis (PMID: 34079082). The molecular weight of Glypican-5 is 63 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34039 Product name: Recombinant human GPC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-225 aa of BC039730 Sequence: EGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAASVQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPQRVMGQMGRSLLPSRTF Predict reactive species\nFull Name: glypican 5\nCalculated Molecular Weight: 572 aa, 64 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC039730\nGene Symbol: Glypican 5\nGene ID (NCBI): 2262\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P78333\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653015721,"sku":"30999-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30999-1-ap","provider":"Iright","version":"1.0","type":"link"}