{"product_id":"proteintech-31001-1-ap","title":"Proteintech, 31001-1-AP, LRMDA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRMDA (31001-1-AP) by Proteintech is a Polyclonal antibody targeting LRMDA in WB, IHC, ELISA applications with reactivity to human, mouse samples\n31001-1-AP targets LRMDA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, THP-1 cells\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe LRMDA gene, also known as C10orf11, encodes a leucine-rich repeating protein that is thought to play a role in melanocyte differentiation. Variants in this gene have been associated with autosomal recessive oculocutaneous albinism 7 (OCA7), but have never been implicated in metabolic disorders. Interestingly, however, the variant associated with age at diabetes onset is also associated with differences in LRMDA expression in the brain, including the hypothalamus, where peptides controlling pigmentation, such as melanocortins and their receptors, are involved in the regulation of body weight and metabolism. (PMID: 36104811)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33898 Product name: Recombinant human LRMDA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of NM_032024 Sequence: MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL Predict reactive species\nFull Name: chromosome 10 open reading frame 11\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: NM_032024\nGene Symbol: LRMDA\/C10orf11\nGene ID (NCBI): 83938\nRRID: AB_3669812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H2I8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887707312297,"sku":"31001-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31001-1-ap","provider":"Iright","version":"1.0","type":"link"}