{"product_id":"proteintech-31032-1-ap","title":"Proteintech, 31032-1-AP, ADAMTS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAMTS2 (31032-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n31032-1-AP targets ADAMTS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A375 cells,  PC-3 cells,  THP-1 cell,  COLO 205 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nA disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS-2) is a metalloproteinase that plays a key role in the processing of fibrillar procollagen precursors into mature collagen molecules by excising the amino-propeptide. ADAMTS-2 can, like the procollagen C-proteinases, be regulated by transforming growth factor-β1 (TGF-β1), with implications for mechanisms whereby this growth factor effects net increases in formation of extracellular matrix. Mutations in the ADAMTS-2 gene cause dermatosparaxis in human (dermatosparactic type of Ehlers-Danlos syndrome, also known as Ehlers-Danlos syndrome type VIIC). Human ADAMTS-2 has eight potential sites for Asn-linked glycosylation and other mammals (PMID: 16046392, 12646579).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34957 Product name: Recombinant human ADAMTS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1091-1211 aa of NM_014244 Sequence: KSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF Predict reactive species\nFull Name: ADAM metallopeptidase with thrombospondin type 1 motif, 2\nCalculated Molecular Weight: 135 kDa\nObserved Molecular Weight: 110~130 kDa\nGenBank Accession Number: NM_014244\nGene Symbol: ADAMTS2\nGene ID (NCBI): 9509\nRRID: AB_3669823\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95450\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869802811561,"sku":"31032-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31032-1-ap","provider":"Iright","version":"1.0","type":"link"}