{"product_id":"proteintech-31043-1-ap","title":"Proteintech, 31043-1-AP, NRG1, isoform Alpha Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRG1, isoform Alpha (31043-1-AP) by Proteintech is a Polyclonal antibody targeting NRG1, isoform Alpha in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31043-1-AP targets NRG1, isoform Alpha in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A549 cells,  HeLa cells,  MCF-7 cells,  SH-SY5Y cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse cerebellum tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuregulin 1 (NRG1) is a trophic factor that has been implicated in neural development, neurotransmission, and synaptic plasticity. NRG1 has multiple isoforms that are generated by usage of different promoters and alternative splicing of a single gene. NRG1 and its receptor ErbB tyrosine kinase are expressed not only in the developing nervous system, but also in the adult brain. The immunogen of this antibody is against NRG1 isoform Alpha.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species\nFull Name: neuregulin 1\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC007675\nGene Symbol: NRG1\nGene ID (NCBI): 3084\nRRID: AB_3669828\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887742111913,"sku":"31043-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31043-1-ap","provider":"Iright","version":"1.0","type":"link"}