{"product_id":"proteintech-31045-1-ap","title":"Proteintech, 31045-1-AP, TRPV6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRPV6 (31045-1-AP) by Proteintech is a Polyclonal antibody targeting TRPV6 in WB, ELISA applications with reactivity to Human, mouse samples\n31045-1-AP targets TRPV6 in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, human placenta tissue,  mouse brain tissue,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRPV6, also named as CAT1 or ECaC2, is a member of the transient receptor potential (TRP) family of membrane proteins. Unlike most TRP channels, TRPV6 and its closest relative, TRPV5, are calcium-selective channels. TRPV6 is highly expressed in the proximal intestine, placenta and exocrine tissues (PMID: 12869611). It is probably involved in calcium absorption in various tissues, including calcium reabsorption in kidney. TRPV6 is overexpressed in some cancers and exhibits oncogenic potential.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34052 Product name: Recombinant human TRPV6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 670-765 aa of NM_018646 Sequence: FLRVEDRQDLNRQRIQRYAQAFHTRGSEDLDKDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI* Predict reactive species\nFull Name: transient receptor potential cation channel, subfamily V, member 6\nCalculated Molecular Weight: 87KD\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: NM_018646\nGene Symbol: TRPV6\nGene ID (NCBI): 55503\nRRID: AB_3669830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H1D0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869781938345,"sku":"31045-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31045-1-ap","provider":"Iright","version":"1.0","type":"link"}