{"product_id":"proteintech-31064-1-ap","title":"Proteintech, 31064-1-AP, STK39 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK39 (31064-1-AP) by Proteintech is a Polyclonal antibody targeting STK39 in WB, ELISA applications with reactivity to human samples\n31064-1-AP targets STK39 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, SH-SY5Y cells,  SK-N-SH cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTK39 (Serine\/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34503 Product name: Recombinant human STK39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 396-455 aa of BC166614 Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV Predict reactive species\nFull Name: serine threonine kinase 39 (STE20\/SPS1 homolog, yeast)\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 60, 68 kDa\nGenBank Accession Number: BC166614\nGene Symbol: STK39\nGene ID (NCBI): 27347\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UEW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887818330281,"sku":"31064-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31064-1-ap","provider":"Iright","version":"1.0","type":"link"}