{"product_id":"proteintech-31066-1-ap","title":"Proteintech, 31066-1-AP, PET117 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PET117 (31066-1-AP) by Proteintech is a Polyclonal antibody targeting PET117 in WB, IHC, ELISA applications with reactivity to human samples\n31066-1-AP targets PET117 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPET117 is a chaperone protein involved in complex IV assembly that plays a role in the regulation of mitochondria-encoded cytochrome c oxidase 1 (COX1) protein synthesis in human cells (PMID: 37247699).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34525 Product name: Recombinant human PET117 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-81 aa of NX_Q6UWS5 Sequence: VHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAEREKMLLAKGSQKS Predict reactive species\nFull Name: Protein PET117 homolog, mitochondrial\nCalculated Molecular Weight: 81aa, 9 kDa\nObserved Molecular Weight: 10kDa\nGenBank Accession Number: NX_Q6UWS5\nGene Symbol: PET117\nGene ID (NCBI): 100303755\nRRID: AB_3669839\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6UWS5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887757316265,"sku":"31066-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31066-1-ap","provider":"Iright","version":"1.0","type":"link"}