{"product_id":"proteintech-31068-1-ap","title":"Proteintech, 31068-1-AP, NTT4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NTT4 (31068-1-AP) by Proteintech is a Polyclonal antibody targeting NTT4 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n31068-1-AP targets NTT4 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse brain tissue, unboiled mouse cerebellum tissue,  unboiled rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC6A17 also known as NTT4, is a member of the SLC6 family of transporters, which are responsible for the presynaptic uptake of most neurotransmitters. SLC6A17 is a transporter for neutral amino acids and is exclusively expressed in the brain(PMID: 23672601). Defects in SLC6A17 cause Intellectual developmental disorder, autosomal recessive 48(PMID: 25704603). For optimal WB detection with 31068-1-AP, we do not recommend boiling the sample after lysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34522 Product name: Recombinant human SLC6A17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-440 aa of NM_001010898 Sequence: GFKANIMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGL Predict reactive species\nFull Name: solute carrier family 6, member 17\nCalculated Molecular Weight: 727 aa, 81 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001010898\nGene Symbol: NTT4\nGene ID (NCBI): 388662\nRRID: AB_3669841\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H1V8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887743783081,"sku":"31068-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31068-1-ap","provider":"Iright","version":"1.0","type":"link"}