{"product_id":"proteintech-31079-1-ap","title":"Proteintech, 31079-1-AP, DNAH5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAH5 (31079-1-AP) by Proteintech is a Polyclonal antibody targeting DNAH5 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31079-1-AP targets DNAH5 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDynein axonemal heavy chain 5 (DNAH5) is an axonemal heavy chain dynein, part of a microtubule-associated motor protein complex. DNAH5 is a large gene comprising 79 exons and one alternative first exon and encodes a heavy chain of the ODA. We have recently shown that recessive DNAH5 mutations are responsible for PCD characterized by ODA defects. DNAH5 mutations cause PCD and randomization of left-right asymmetry (PMID: 15750039).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34647 Product name: Recombinant human DNAH5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-150 aa of NM_001369 Sequence: LNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSF Predict reactive species\nFull Name: dynein, axonemal, heavy chain 5\nCalculated Molecular Weight: 529 kDa\nGenBank Accession Number: NM_001369\nGene Symbol: DNAH5\nGene ID (NCBI): 1767\nRRID: AB_3669844\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8TE73\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887246004393,"sku":"31079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31079-1-ap","provider":"Iright","version":"1.0","type":"link"}