{"product_id":"proteintech-31083-1-ap","title":"Proteintech, 31083-1-AP, GOLIM4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GOLIM4 (31083-1-AP) by Proteintech is a Polyclonal antibody targeting GOLIM4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31083-1-AP targets GOLIM4 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGolgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis\/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and\nendosomes, and its shuttle is pH sensitive(PMID:30068697).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34962 Product name: Recombinant human GOLIM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-500 aa of NM_014498 Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ Predict reactive species\nFull Name: golgi integral membrane protein 4\nCalculated Molecular Weight: 82 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: NM_014498\nGene Symbol: GOLIM4\nGene ID (NCBI): 27333\nRRID: AB_3669846\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O00461\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869545713833,"sku":"31083-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31083-1-ap","provider":"Iright","version":"1.0","type":"link"}