{"product_id":"proteintech-31090-1-ap","title":"Proteintech, 31090-1-AP, Atox1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Atox1 (31090-1-AP) by Proteintech is a Polyclonal antibody targeting Atox1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31090-1-AP targets Atox1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAntioxidant 1 copper chaperone (Atox1) is a small cytosolic protein containing an MBS (metal binding site) and a potential NLS (nuclear localisation signal). It plays an essential role in copper homeostasis by facilitating the transfer of copper to the trans-Golgi. Atox1 has been implicated in a wide range of diseases, including many neurodegenerative, cancer and metabolic disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35290 Product name: Recombinant mouse Atox1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of NM_009720 Sequence: MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGKAVSYLGPK Predict reactive species\nFull Name: ATX1 (antioxidant protein 1) homolog 1 (yeast)\nCalculated Molecular Weight: 7 kDa\nObserved Molecular Weight: 7-10 kDa\nGenBank Accession Number: NM_009720\nGene Symbol: Atox1\nGene ID (NCBI): 11927\nRRID: AB_3669848\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O08997\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885099602089,"sku":"31090-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31090-1-ap","provider":"Iright","version":"1.0","type":"link"}