{"product_id":"proteintech-31091-1-ap","title":"Proteintech, 31091-1-AP, CORO1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CORO1B (31091-1-AP) by Proteintech is a Polyclonal antibody targeting CORO1B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31091-1-AP targets CORO1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, MDA-MB-453 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse liver tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCORO1B (Coronin 1B) is an actin-binding protein that controls actin networks at classical lamellipodia (PMID: 32850828). Coro1B localizes to the plasma membrane, regulates lamellipodia formation, and when phosphorylated, it can no longer bind ARP2\/3 and inhibit its actin nucleation abilities (PMID: 22619279).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34813 Product name: Recombinant human CORO1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 393-489 aa of BC006449 Sequence: REAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA Predict reactive species\nFull Name: coronin, actin binding protein, 1B\nCalculated Molecular Weight: 498 aa, 54 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC006449\nGene Symbol: CORO1B\nGene ID (NCBI): 57175\nRRID: AB_3669849\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BR76\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886821658793,"sku":"31091-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31091-1-ap","provider":"Iright","version":"1.0","type":"link"}