{"product_id":"proteintech-31094-1-ap","title":"Proteintech, 31094-1-AP, IKZF4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IKZF4 (31094-1-AP) by Proteintech is a Polyclonal antibody targeting IKZF4 in WB, ELISA applications with reactivity to human samples\n31094-1-AP targets IKZF4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, Raji cells,  THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIKZF4 is a member of the Ikaros family transcription factors. The Ikaros family was originally designated to function in hematopoiesis, but it is only recently that studies have begun to show the relevance of this family in T helper cell differentiation. IKZF3 was preferentially expressed in TH17 cells and governs TH17 differentiation by silencing IL-2 expression. By investigating the dynamics of the TH17 regulatory network, IKZF4 was proposed by Yosef et al. as a composite in the negative regulatory module for TH17. (PMID: 24644282)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34767 Product name: Recombinant human IKZF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-457 aa of BC160169 Sequence: ERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDST Predict reactive species\nFull Name: IKAROS family zinc finger 4 (Eos)\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC160169\nGene Symbol: IKZF4\nGene ID (NCBI): 64375\nRRID: AB_3669852\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H2S9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887678410921,"sku":"31094-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31094-1-ap","provider":"Iright","version":"1.0","type":"link"}