{"product_id":"proteintech-31159-1-ap","title":"Proteintech, 31159-1-AP, SC4MOL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SC4MOL (31159-1-AP) by Proteintech is a Polyclonal antibody targeting SC4MOL in WB, ELISA applications with reactivity to human, mouse samples\n31159-1-AP targets SC4MOL in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SW 1990 cells, mouse adipose tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSC4MOL(sterol C4-methyl oxidase-like), an intermediate enzyme in the cholesterol biosynthetic pathway, was included in the library based on its representation in a high confidence GEO transcriptional profiling dataset as a transcript that rapidly undergoes significant expression change in response to stimulation or inhibition of EGFR. Among the validated hits that increased cell killing by common EGFR antagonists, SC4MOL was consistently one of the most effective modulators. (PMID: 23125191)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34758 Product name: Recombinant human SC4MOL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-293 aa of BC107879 Sequence: LLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE Predict reactive species\nFull Name: sterol-C4-methyl oxidase-like\nObserved Molecular Weight: 34-36 kDa\nGenBank Accession Number: BC107879\nGene Symbol: SC4MOL\nGene ID (NCBI): 6307\nRRID: AB_3669874\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q15800\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869760770217,"sku":"31159-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31159-1-ap","provider":"Iright","version":"1.0","type":"link"}