{"product_id":"proteintech-31173-1-ap","title":"Proteintech, 31173-1-AP, METTL8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe METTL8 (31173-1-AP) by Proteintech is a Polyclonal antibody targeting METTL8 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n31173-1-AP targets METTL8 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 205 cells, HCT 116 cells,  LoVo cells,  SW480 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMETTL8 (methyltransferase-like protein 8) is an m3C methyltransferase that is best known for its mitochondrial role in installing m3C32 on mt-tRNAThr\/Ser(UCN). METTL8 has proved to be a transcriptional target of STAT3 that mediates STAT3's functions in mESCs (PMID: 29706498). METTL8 has multiple splicing isoforms and can undergo sumoylation and associate with nuclear RNA-binding proteins to regulate R-loop formation on ribosomal DNA gene (presumably via its methyltransferase activity on m3C) (PMID: 38744809).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34222 Product name: Recombinant human METTL8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC025250 Sequence: MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE Predict reactive species\nFull Name: methyltransferase like 8\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33~40 kDa\nGenBank Accession Number: BC025250\nGene Symbol: METTL8\nGene ID (NCBI): 79828\nRRID: AB_3669881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H825\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887717896361,"sku":"31173-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31173-1-ap","provider":"Iright","version":"1.0","type":"link"}