{"product_id":"proteintech-31174-1-ap","title":"Proteintech, 31174-1-AP, DLST Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLST (31174-1-AP) by Proteintech is a Polyclonal antibody targeting DLST in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31174-1-AP targets DLST in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDLST (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex) ) is the E2 transferase of α-ketoglutarate dehydrogenase complex (KGDHC) that regulates the irreversible conversion of α-ketoglutarate to succinyl-CoA in the TCA cycle.RNAi knockdown\nof DLST led to decreased cell viability and induction of apoptosis in human T-ALL cell lines. High DLST expression predicts poor overall and recurrencefree survival among TNBC patients (PMID: 26876595, 34785772). DLST has two isoforms of 40 kDa, 49 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34753 Product name: Recombinant human DLST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 212-366 aa of BC001922 Sequence: EPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDG Predict reactive species\nFull Name: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 40 kDa, 49 kDa\nGenBank Accession Number: BC001922\nGene Symbol: DLST\nGene ID (NCBI): 1743\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P36957\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887217791145,"sku":"31174-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31174-1-ap","provider":"Iright","version":"1.0","type":"link"}