{"product_id":"proteintech-31181-1-ap","title":"Proteintech, 31181-1-AP, LAMA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAMA2 (31181-1-AP) by Proteintech is a Polyclonal antibody targeting LAMA2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n31181-1-AP targets LAMA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, mouse skeletal muscle tissue,  rat heart tissue\nPositive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe laminin subunit alpha 2 (LAMA2) gene encodes an alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Basal laminae are structural components of the extracellular matrix that influence cell proliferation and differentiation,7 and laminin subunit alpha 2 (LAMA2) is the major component of the basal laminae-α subunit of laminin. (PMID: 30728939)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34494 Product name: Recombinant human LAMA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2100-2250 aa of NM_000426 Sequence: IDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGTISVRALDG Predict reactive species\nFull Name: laminin, alpha 2\nCalculated Molecular Weight: 344 kDa\nObserved Molecular Weight: 344 kDa\nGenBank Accession Number: NM_000426\nGene Symbol: LAMA2\nGene ID (NCBI): 3908\nRRID: AB_3669885\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P24043\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887700889769,"sku":"31181-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-31181-1-ap","provider":"Iright","version":"1.0","type":"link"}